NCAPD2 antibody (C-Term)

Catalog No. ABIN634129

This Rabbit Polyclonal antibody specifically detects NCAPD2 in WB. It exhibits reactivity toward Human.

Quick Overview for NCAPD2 antibody (C-Term) (ABIN634129)

Target: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NCAPD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NCAPD2 Antibody

Binding Specificity: C-Term

Specificity: NCAPD2 antibody was raised against the C terminal of NCAPD2

Purification: Affinity purified

Immunogen: NCAPD2 antibody was raised using the C terminal of NCAPD2 corresponding to a region with amino acids KAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPSTGSRYQPL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NCAPD2 Blocking Peptide, (ABIN939632), is also available for use as a blocking control in assays to test for specificity of this NCAPD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NCAPD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NCAPD2

Target: NCAPD2 (Non-SMC Condensin I Complex, Subunit D2 (NCAPD2))

Alternative Name: NCAPD2

Background: NCAPD2 is the regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. NCAPD2 may target the condensin complex to DNA via its C-terminal domain.

Molecular Weight: 157 kDa (MW of target protein)